PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D01G0956
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SRS
Protein Properties Length: 308aa    MW: 34287 Da    PI: 6.982
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D01G0956genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702230.43.1e-71922422154
       DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                  ++g+++CqdCGnqakkdCah+RCRtCCksrgf+C+thvkstWvpaakrrerqqqlaa++++++++ +   ++ kr  +++ + +l++t+ls ++s   
  Gh_D01G0956  92 KHGGMNCQDCGNQAKKDCAHMRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLAALQHHQQHEDQFRGENPKRLRENQGSPSLACTRLSPTTSG-- 187
                  6899******************************************************99999888555555555555688889999999988765.. PP

       DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                  le  ++P+evss+avfr+v+vs++dd++ee+aYqtav+i+GhvfkGiLydqG+e+
  Gh_D01G0956 188 LELGQFPPEVSSPAVFRSVKVSAMDDEDEEFAYQTAVNIAGHVFKGILYDQGPES 242
                  88899************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.0E-6795241IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.1E-2797139IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.4E-25192240IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048467Biological Processgynoecium development
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MAGLFYLGGR EADTGNKQEE DKEESLYLYR NEEIYNKGFE IWPQYYYHQQ QQQQQQENVN  60
TISFGAGPSR RARGFNLSDE PSSRSVGFTV MKHGGMNCQD CGNQAKKDCA HMRCRTCCKS  120
RGFQCQTHVK STWVPAAKRR ERQQQLAALQ HHQQHEDQFR GENPKRLREN QGSPSLACTR  180
LSPTTSGLEL GQFPPEVSSP AVFRSVKVSA MDDEDEEFAY QTAVNIAGHV FKGILYDQGP  240
ESHYTGGGES SQQLNLITAA VTTAETARTT TTAAISSNPA TSMLDPSLYP APLNAFIAGT  300
QFFPPPRS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO722697983e-99
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6162870.0JX616287.1 Gossypium hirsutum clone NBRI_GE60826 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012466169.10.0PREDICTED: protein SHI RELATED SEQUENCE 5-like
SwissprotQ9LQZ51e-102SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLA0A0D2QC220.0A0A0D2QC22_G
STRINGPOPTR_0002s03000.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.15e-90SHI-related sequence 5